PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G22730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 244aa    MW: 26038.1 Da    PI: 6.0254
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G22730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.4e-3937134198
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rr+C+++C la+yfpa+qp++f+n+h+lFG +n+l+++++++ee r+dam+s+vye++a++ dPv Ga+g+++ l+q+l++lkael
  ONIVA01G22730.1  37 ACAACKHQRRRCTPECRLARYFPANQPARFRNAHRLFGIKNILRVMASASEELRDDAMKSVVYESDAWVIDPVGGAAGIVKGLSQELARLKAEL 130
                      7********************************************************************************************* PP

           DUF260  95 allk 98 
                      +++k
  ONIVA01G22730.1 131 DAVK 134
                      9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.78136137IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-3537134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGDEEAGPSS SGHSSPTSNT STTPPPQPPP PPPHPQACAA CKHQRRRCTP ECRLARYFPA  60
NQPARFRNAH RLFGIKNILR VMASASEELR DDAMKSVVYE SDAWVIDPVG GAAGIVKGLS  120
QELARLKAEL DAVKGLIELH RRAAAQQQQQ PPVAVASNGG FLPSPPPPPQ GQQQLLFLPP  180
PPPTMMLQDG HCDDETVEDD YLVDPPAVDA AAATSTAPER HGDGHAPTAN VKEEGNVDHT  240
SSTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0033080.0AP003308.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1129G05.
GenBankAP0034130.0AP003413.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1151A10.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638299.17e-89PREDICTED: LOB domain-containing protein 11-like
TrEMBLA0A0E0FND21e-179A0A0E0FND2_ORYNI; Uncharacterized protein
STRINGORGLA01G0167100.11e-112(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP158291113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-28LOB domain-containing protein 22